Solution structure of avenatide av1
PDB DOI: 10.2210/pdb6m5c/pdb
Classification: PLANT PROTEIN Organism(s): Vibrio Cholerae O1 Biovar Eltor Str. N16961
Deposited: 2020-03-10 Deposition Author(s): Fan, J.S. , Huang, J.Y. , Tam, J.P. , Tay, S.V. , Wong, K.H. , Yang, D.W.
Solution structure of avenatide av1
Fan, J.S. , Huang, J.Y. , Tam, J.P. , Tay, S.V. , Wong, K.H. , Yang, D.W.
Primary Citation of Related Structures: 6M5C
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
avenatide aV1 | A | 39 | Vibrio Cholerae O1 Biovar Eltor Str. N16961 | ACSSSSPCPGNQCCSKWGYCGLGGDYCGSGCQSGPCTGA |
Method: SOLUTION NMR
Deposited Date: 2020-03-10 Deposition Author(s): Fan, J.S. , Huang, J.Y. , Tam, J.P. , Tay, S.V. , Wong, K.H. , Yang, D.W.