X-ray crystal structure of tandemly connected engrailed homeodomains (ehd) with r53a mutations and dna complex
PDB DOI: 10.2210/pdb6m3d/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2020-03-03 Deposition Author(s): Hirano, Y. , Kono, H. , Sunami, T. , Tamada, T.
X-ray crystal structure of tandemly connected engrailed homeodomains (ehd) with r53a mutations and dna complex
Hirano, Y. , Kono, H. , Sunami, T. , Tamada, T.
Primary Citation of Related Structures: 6M3D
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Segmentation polarity homeobox protein engrailed,Segmentation polarity homeobox protein engrailed | C | 148 | Drosophila Melanogaster , Synthetic Construct | MGSSHHHHHHAIEDLYFQSPGDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKAAKIKKSGGGGGDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKAAKIKKSGT |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-03-03 Deposition Author(s): Hirano, Y. , Kono, H. , Sunami, T. , Tamada, T.