6M2A
A non-his-rich type of chimeric sirohydrochlorin nickelochelatase cfba from m. jannaschii and m. barkeri
PDB DOI: 10.2210/pdb6m2a/pdb
Classification: BIOSYNTHETIC PROTEIN Organism(s): Penicillium Herquei , Sulfolobus Islandicus (Strain Rey15A)
Deposited: 2020-02-26 Deposition Author(s): Fujishiro, T.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.23 Å
A non-his-rich type of chimeric sirohydrochlorin nickelochelatase cfba from m. jannaschii and m. barkeri
Primary Citation of Related Structures: 6M2A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sirohydrochlorin cobaltochelatase,Sirohydrochlorin cobaltochelatase,Sirohydrochlorin cobaltochelatase | A | 126 | Penicillium Herquei , Sulfolobus Islandicus (Strain Rey15A) | MEALVLVGHGSRLPYSKELLVKLAEKVKERNLFPIVEIGLMEFSEPTIPQAVKKAIEQGAKRIIVVPVFLAHGIHTTRDIPRLLGLDENGCGTLEIDGKTVEIIYREPIGADDRIVDIIIDRAFGR |
| Sirohydrochlorin cobaltochelatase,Sirohydrochlorin cobaltochelatase,Sirohydrochlorin cobaltochelatase | B | 126 | Penicillium Herquei , Sulfolobus Islandicus (Strain Rey15A) | MEALVLVGHGSRLPYSKELLVKLAEKVKERNLFPIVEIGLMEFSEPTIPQAVKKAIEQGAKRIIVVPVFLAHGIHTTRDIPRLLGLDENGCGTLEIDGKTVEIIYREPIGADDRIVDIIIDRAFGR |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-02-26 Deposition Author(s): Fujishiro, T.