Crystal structure of hiv-1 integrase catalytic core domain in complex with 2-(tert-butoxy)-2-[3-(3,4-dihydro-2h-1,4-benzoxazin-6-yl)-6-methanesulfonamido-2,3',4',5-tetramethyl-[1,1'-biphenyl]-4-yl]acetic acid
PDB DOI: 10.2210/pdb6lmq/pdb
Classification: TRANSFERASE Organism(s): Human Immunodeficiency Virus Type 1 Group M Subtype B (Isolate Ny5)
Deposited: 2019-12-26 Deposition Author(s): Arita, S. , Iwaki, T. , Kawasuji, T. , Matsuoka, E. , Seki, T. , Sugiyama, S. , Tamura, Y. , Tomita, K. , Yoshinaga, T.
Crystal structure of hiv-1 integrase catalytic core domain in complex with 2-(tert-butoxy)-2-[3-(3,4-dihydro-2h-1,4-benzoxazin-6-yl)-6-methanesulfonamido-2,3',4',5-tetramethyl-[1,1'-biphenyl]-4-yl]acetic acid
Arita, S. , Iwaki, T. , Kawasuji, T. , Matsuoka, E. , Seki, T. , Sugiyama, S. , Tamura, Y. , Tomita, K. , Yoshinaga, T.
Primary Citation of Related Structures: 6LMQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Integrase catalytic | A | 166 | Human Immunodeficiency Virus Type 1 Group M Subtype B (Isolate Ny5) | GSHMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQTKE |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-26 Deposition Author(s): Arita, S. , Iwaki, T. , Kawasuji, T. , Matsuoka, E. , Seki, T. , Sugiyama, S. , Tamura, Y. , Tomita, K. , Yoshinaga, T.