Crystal structure of chaetomium gcp3 n-terminus and mozart1
PDB DOI: 10.2210/pdb6l7r/pdb
Classification: TRANSLATION Organism(s): Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719)
Deposited: 2019-11-02 Deposition Author(s): Hsia, K.C. , Huang, T.L. , Wang, H.J.
Crystal structure of chaetomium gcp3 n-terminus and mozart1
Hsia, K.C. , Huang, T.L. , Wang, H.J.
Primary Citation of Related Structures: 6L7R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative spindle pole body component alp6 protein | A | 107 | Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719) | GPLGSMQRINNAIDSLIGHLVPAAAGDDDDARTRRQAVFDLVRALLEQPGSNIPSDVNHASDLIKRRLISTNPSQALRFSNLYTRLLALPVLNQKWAILYLLHQLAD |
| Mozart1 | B | 86 | Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719) | GPHMPPSERAEKQAAAQQAVDILHEIATILNCHLDRRTLSICISMIENGVNPEALANVIKELRVLGQDPQQLDALVANYLASSRRR |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-11-02 Deposition Author(s): Hsia, K.C. , Huang, T.L. , Wang, H.J.