PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6KZU

Macrocyclization of an all-d linear peptide improves target affinity and imparts cellular activity: a novel stapled alpha-helical peptide modality

PDB DOI: 10.2210/pdb6kzu/pdb

Classification: LIGASE
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2019-09-25
Deposition Author(s): Brown, C.J. , Jiang, S.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.79 Å

Literature

Macrocyclization of an all-d linear peptide improves target affinity and imparts cellular activity: a novel stapled alpha-helical peptide modality

Brown, C.J. , Jiang, S.

Primary Citation of Related Structures: 6KZU


Proteins
Molecule Chains Sequence Length Organism Sequence
E3 ubiquitin-protein ligase Mdm2 A 122 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN
2JN-DAL-E03-DTY-2JN-DSG-TDF-DGL-MK8-DLE-DLE-2JN B 12 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XAXYXNXELLLX
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2019-09-25
Deposition Author(s): Brown, C.J. , Jiang, S.