Crystal structure of plasmodium falciparum histo-aspartic protease (hap) zymogen (form 1)
PDB DOI: 10.2210/pdb6kub/pdb
Classification: HYDROLASE Organism(s): Plasmodium Falciparum
Deposited: 2019-08-31 Deposition Author(s): Bhaumik, P. , Mishra, V. , Rathore, I.
Crystal structure of plasmodium falciparum histo-aspartic protease (hap) zymogen (form 1)
Bhaumik, P. , Mishra, V. , Rathore, I.
Primary Citation of Related Structures: 6KUB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HAP protein | A | 380 | Plasmodium Falciparum | AISDPKYSTVGFNIENSYDRLMKTIKEHKLKNYIKESVKLFNKGLTKKSYLGSEFDNVELKDLANVLSFGEAKLGDNGQKFNFLFHTASSNVWVPSIKCTSESCESKNHYDSSKSKTYEKDDTPVKLTSKAGTISGIFSKDLVTIGKLSVPYKFIEMTEIVGFEPFYSESDVDGVFGLGWKDLSIGSIDPYIVELKTQNKIEQAVYSIYLPPENKNKGYLTIGGIEERFFDGPLNYEKLNHDLMWQVDLDVHFGNVSSKKANVILDSATSVITVPTEFFNQFVESASVFKVPFLSLYVTTCGNTKLPTLEYRSPNKVYTLEPKQYLEPLENIFSALCMLNIVPIDLEKNTFVLGDPFMRKYFTVYDYDNHTVGFALAKNL |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-08-31 Deposition Author(s): Bhaumik, P. , Mishra, V. , Rathore, I.