Crystal structure of brd4-brmo2 in complex with h2a.zk4ack7ac peptide
PDB DOI: 10.2210/pdb6ko2/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-08-07 Deposition Author(s): Li, H.T. , Zheng, S.P.
Crystal structure of brd4-brmo2 in complex with h2a.zk4ack7ac peptide
Primary Citation of Related Structures: 6KO2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bromodomain-containing protein 4 | A | 111 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKM |
histone H2A.Z peptide | B | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GKAGKDS |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-08-07 Deposition Author(s): Li, H.T. , Zheng, S.P.