PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6KMJ

Crystal structure of sth1 bromodomain in complex with h3k14ac

PDB DOI: 10.2210/pdb6kmj/pdb

Classification: GENE REGULATION
Organism(s): Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2019-07-31
Deposition Author(s): Chen, G. , Chen, Y. , Li, W. , Wang, D. , Yan, F.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.4 Å

6kmj
Literature

Crystal structure of sth1 bromodomain in complex with h3k14ac

Chen, G. , Chen, Y. , Li, W. , Wang, D. , Yan, F.

Primary Citation of Related Structures: 6KMJ


Proteins
Molecule Chains Sequence Length Organism Sequence
Nuclear protein STH1/NPS1 A 112 Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) SLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLNEFTDEWFKEHSS
Histone H3 C 17 Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) TARKSTGGKAPRKQLAY
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2019-07-31
Deposition Author(s): Chen, G. , Chen, Y. , Li, W. , Wang, D. , Yan, F.