Crystal structure of zika ns2b-ns3 protease with compound 9
PDB DOI: 10.2210/pdb6kk4/pdb
Classification: VIRAL PROTEIN Organism(s): Zika Virus , Zika Virus (Strain Mr 766)
Deposited: 2019-07-23 Deposition Author(s): Quek, J.P.
Crystal structure of zika ns2b-ns3 protease with compound 9
Primary Citation of Related Structures: 6KK4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine protease subunit NS2B | A | 53 | Zika Virus , Zika Virus (Strain Mr 766) | MTGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMRE |
| NS3 protease | B | 178 | Zika Virus , Zika Virus (Strain Mr 766) | GSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKREEETPVE |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-07-23 Deposition Author(s): Quek, J.P.