Solution structure of bovine insulin amyloid intermediate-2
PDB DOI: 10.2210/pdb6kha/pdb
Classification: HORMONE Organism(s): Bos Taurus
Deposited: 2019-07-14 Deposition Author(s): Bhunia, A. , Brender, J.B. , Kar, R.K. , Ratha, B.N.
Solution structure of bovine insulin amyloid intermediate-2
Bhunia, A. , Brender, J.B. , Kar, R.K. , Ratha, B.N.
Primary Citation of Related Structures: 6KHA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Bos Taurus | GIVEQCCASVCSLYQLENYCN |
Insulin B chain | B | 30 | Bos Taurus | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Method: SOLUTION NMR
Deposited Date: 2019-07-14 Deposition Author(s): Bhunia, A. , Brender, J.B. , Kar, R.K. , Ratha, B.N.