Solution structure of zn free bovine pancreatic insulin in 20% acetic acid-d4 (ph 1.9)
PDB DOI: 10.2210/pdb6kh8/pdb
Classification: HORMONE Organism(s): Parengyodontium Album
Deposited: 2019-07-14 Deposition Author(s): Bhunia, A. , Brender, J.R. , Kar, R.K. , Ratha, B.N.
Solution structure of zn free bovine pancreatic insulin in 20% acetic acid-d4 (ph 1.9)
Bhunia, A. , Brender, J.R. , Kar, R.K. , Ratha, B.N.
Primary Citation of Related Structures: 6KH8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A Chain | A | 21 | Parengyodontium Album | GIVEQCCASVCSLYQLENYCN |
Insulin B chain | B | 30 | Parengyodontium Album | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Method: SOLUTION NMR
Deposited Date: 2019-07-14 Deposition Author(s): Bhunia, A. , Brender, J.R. , Kar, R.K. , Ratha, B.N.