Complex of sumo2 with phosphorylated viral sim ie2
PDB DOI: 10.2210/pdb6k5r/pdb
Classification: PROTEIN BINDING/TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-05-30 Deposition Author(s): Chatterjee, K.S. , Das, R.
Complex of sumo2 with phosphorylated viral sim ie2
Primary Citation of Related Structures: 6K5R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Small ubiquitin-related modifier 3 | A | 77 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTG |
ASP-THR-ALA-GLY-CYS-ILE-VAL-ILE-SEP-ASP-SEP-GLU | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DTAGCIVISDSE |
Method: SOLUTION NMR
Deposited Date: 2019-05-30 Deposition Author(s): Chatterjee, K.S. , Das, R.