The solution structure of the smart chimeric peptide g6
PDB DOI: 10.2210/pdb6k4v/pdb
Classification: ANTIBIOTIC Organism(s): N.A.
Deposited: 2019-05-27 Deposition Author(s): Liu, X.H. , Wang, J.H.
Method: SOLUTION NMR Resolution: N.A.
The solution structure of the smart chimeric peptide g6
Primary Citation of Related Structures: 6K4V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| smart chimeric peptide G6 | A | 40 | N.A. | RVQGRWKVRASFFKGGGGSGFAWNVCVYRNGVRVCHRRAN |
Method: SOLUTION NMR
Deposited Date: 2019-05-27 Deposition Author(s): Liu, X.H. , Wang, J.H.