Crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna
PDB DOI: 10.2210/pdb6jhe/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Nectria Haematococca Mpvi , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-02-18 Deposition Author(s): Dahal, P. , Devkota, S.R. , Kim, D.Y. , Kwon, E. , Pathak, D.
Crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna
Dahal, P. , Devkota, S.R. , Kim, D.Y. , Kwon, E. , Pathak, D.
Primary Citation of Related Structures: 6JHE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ECF RNA polymerase sigma factor SigW | A | 64 | Nectria Haematococca Mpvi , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSLSNTIQQKILKLPDKYRTVIVLKYIDELSLIEIGEILNIPVGTVKTRIHRGREALRKQLRDL |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-02-18 Deposition Author(s): Dahal, P. , Devkota, S.R. , Kim, D.Y. , Kwon, E. , Pathak, D.