Crystal structure of i13v/i62v/v77i south african hiv-1 subtype c protease containing a d25a mutation
PDB DOI: 10.2210/pdb6i45/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus 1
Deposited: 2018-11-09 Deposition Author(s): Achilonu, I.A. , Dirr, H.W. , Pandian, R. , Sayed, Y. , Sherry, D.
Crystal structure of i13v/i62v/v77i south african hiv-1 subtype c protease containing a d25a mutation
Achilonu, I.A. , Dirr, H.W. , Pandian, R. , Sayed, Y. , Sherry, D.
Primary Citation of Related Structures: 6I45
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVSVKVGGQIKEALLATGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQVLIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-11-09 Deposition Author(s): Achilonu, I.A. , Dirr, H.W. , Pandian, R. , Sayed, Y. , Sherry, D.