Pilotin from vibrio vulnificus type 2 secretion system, epss.
PDB DOI: 10.2210/pdb6i2v/pdb
Classification: PROTEIN BINDING Organism(s): Vibrio Vulnificus
Deposited: 2018-11-02 Deposition Author(s): Bertrand, Q. , Contreras-Martel, C. , Dessen, A. , Estrozi, L. , Fenel, D. , Howard, S.P. , Job, V. , Martins, A. , Schoehn, G. , Strozen, T.
Pilotin from vibrio vulnificus type 2 secretion system, epss.
Bertrand, Q. , Contreras-Martel, C. , Dessen, A. , Estrozi, L. , Fenel, D. , Howard, S.P. , Job, V. , Martins, A. , Schoehn, G. , Strozen, T.
Primary Citation of Related Structures: 6I2V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 114 | Vibrio Vulnificus | GSSSNGEKERQLELMASNRAGVLSAGLPIEYGPLKVMRISSSKNIVEIMMIYNTDATGAKPTQELLSTSVSKYCEDATVRNQLDMGLMYRIKIRNSRGQLIIDEMVTAASCQPQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-11-02 Deposition Author(s): Bertrand, Q. , Contreras-Martel, C. , Dessen, A. , Estrozi, L. , Fenel, D. , Howard, S.P. , Job, V. , Martins, A. , Schoehn, G. , Strozen, T.