Crystal structure of the tudor domain of human ercc6-l2
PDB DOI: 10.2210/pdb6hq9/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2018-09-24 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A. , Gavard, A.E. , Gileadi, O. , Nathan, W.J. , Newman, J.A. , Pinkas, D.M. , Von Delft, F.
Crystal structure of the tudor domain of human ercc6-l2
Arrowsmith, C.H. , Bountra, C. , Edwards, A. , Gavard, A.E. , Gileadi, O. , Nathan, W.J. , Newman, J.A. , Pinkas, D.M. , Von Delft, F.
Primary Citation of Related Structures: 6HQ9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA excision repair protein ERCC-6-like 2 | A | 69 | Homo Sapiens | SMKDIWHPGERCLAPSPDNGKLCEASIKSITVDENGKSFAVVLYADFQERKIPLKQLQEVKFVKDCPRN |
| DNA excision repair protein ERCC-6-like 2 | B | 69 | Homo Sapiens | SMKDIWHPGERCLAPSPDNGKLCEASIKSITVDENGKSFAVVLYADFQERKIPLKQLQEVKFVKDCPRN |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-24 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A. , Gavard, A.E. , Gileadi, O. , Nathan, W.J. , Newman, J.A. , Pinkas, D.M. , Von Delft, F.