Structure of beclin1 lir motif bound to gabarapl1
PDB DOI: 10.2210/pdb6hoi/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-09-17 Deposition Author(s): Bhujbal, Z. , Birgisdottir, A.B. , Evjen, G. , Johansen, T. , Lamark, T. , Lee, R. , Mouilleron, S. , O'Reilly, N. , Sjottem, E. , Tooze, S. , Wirth, M. , Zhang, W.
Structure of beclin1 lir motif bound to gabarapl1
Bhujbal, Z. , Birgisdottir, A.B. , Evjen, G. , Johansen, T. , Lamark, T. , Lee, R. , Mouilleron, S. , O'Reilly, N. , Sjottem, E. , Tooze, S. , Wirth, M. , Zhang, W.
Primary Citation of Related Structures: 6HOI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Gamma-aminobutyric acid receptor-associated protein-like 1 | A | 123 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPTMGSMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
Gamma-aminobutyric acid receptor-associated protein-like 1 | B | 123 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPTMGSMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
Beclin-1 | F | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SANSFTLIGE |
Beclin-1 | G | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SANSFTLIGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-17 Deposition Author(s): Bhujbal, Z. , Birgisdottir, A.B. , Evjen, G. , Johansen, T. , Lamark, T. , Lee, R. , Mouilleron, S. , O'Reilly, N. , Sjottem, E. , Tooze, S. , Wirth, M. , Zhang, W.