Structure of vps34 lir motif bound to gabarap
PDB DOI: 10.2210/pdb6hog/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2018-09-17 Deposition Author(s): Bhujbal, Z. , Birgisdottir, A.B. , Evjen, G. , Johansen, T. , Lamark, T. , Lee, R. , Mouilleron, S. , O'Reilly, N. , Sjottem, E. , Tooze, S. , Wirth, M. , Zhang, W.
Structure of vps34 lir motif bound to gabarap
Bhujbal, Z. , Birgisdottir, A.B. , Evjen, G. , Johansen, T. , Lamark, T. , Lee, R. , Mouilleron, S. , O'Reilly, N. , Sjottem, E. , Tooze, S. , Wirth, M. , Zhang, W.
Primary Citation of Related Structures: 6HOG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Phosphatidylinositol 3-kinase catalytic subunit type 3,Gamma-aminobutyric acid receptor-associated protein | A | 129 | Salmonella Enterica | SPILTSFELVKVPDPGSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDE |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-17 Deposition Author(s): Bhujbal, Z. , Birgisdottir, A.B. , Evjen, G. , Johansen, T. , Lamark, T. , Lee, R. , Mouilleron, S. , O'Reilly, N. , Sjottem, E. , Tooze, S. , Wirth, M. , Zhang, W.