Selenomethionine derivative of idmh 96-104 loop truncation variant
PDB DOI: 10.2210/pdb6hnl/pdb
Classification: BIOSYNTHETIC PROTEIN Organism(s): Streptomyces Antibioticus
Deposited: 2018-09-16 Deposition Author(s): Berry, A. , Drulyte, I. , Hemsworth, G.R. , Obajdin, J. , Trinh, C.
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Selenomethionine derivative of idmh 96-104 loop truncation variant
Berry, A. , Drulyte, I. , Hemsworth, G.R. , Obajdin, J. , Trinh, C.
Primary Citation of Related Structures: 6HNL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative polyketide cyclase IdmH | A | 139 | Streptomyces Antibioticus | GSHMAHQPSDTIAGLYEAFNSGDLETLRELIAPDAVIHLPGTAGDAEHPPGTPRDREGWLGVWQFTQAFFPDMTATVQDIVQTGDLVATRCVARGTHSGRPFEMTMLNMSRVRDGRIVEHWTISDNVTMLAQLGVKASL |
| Putative polyketide cyclase IdmH | B | 139 | Streptomyces Antibioticus | GSHMAHQPSDTIAGLYEAFNSGDLETLRELIAPDAVIHLPGTAGDAEHPPGTPRDREGWLGVWQFTQAFFPDMTATVQDIVQTGDLVATRCVARGTHSGRPFEMTMLNMSRVRDGRIVEHWTISDNVTMLAQLGVKASL |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-16 Deposition Author(s): Berry, A. , Drulyte, I. , Hemsworth, G.R. , Obajdin, J. , Trinh, C.