Crystal structure of the small subunit-like domain 1 of ccmm from synechococcus elongatus (strain pcc 7942)
PDB DOI: 10.2210/pdb6hbb/pdb
Classification: PROTEIN BINDING Organism(s): Synechococcus Elongatus (Strain Pcc 7942)
Deposited: 2018-08-10 Deposition Author(s): Aigner, H. , Bracher, A. , Hartl, F.U. , Hayer-Hartl, M. , Hee, W.Y. , Long, B.M. , Nguyen, N.D. , Price, G.D. , Wang, H. , Yan, X.
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
Crystal structure of the small subunit-like domain 1 of ccmm from synechococcus elongatus (strain pcc 7942)
Aigner, H. , Bracher, A. , Hartl, F.U. , Hayer-Hartl, M. , Hee, W.Y. , Long, B.M. , Nguyen, N.D. , Price, G.D. , Wang, H. , Yan, X.
Primary Citation of Related Structures: 6HBB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carbon dioxide concentrating mechanism protein CcmM | A | 92 | Synechococcus Elongatus (Strain Pcc 7942) | SEFLSSEVITQVRSLLNQGYRIGTEHADKRRFRTSSWQPCAPIQSTNERQVLSELENCLSEHEGEYVRLLGIDTNTRSRVFEALIQRPDGSV |
| Carbon dioxide concentrating mechanism protein CcmM | B | 92 | Synechococcus Elongatus (Strain Pcc 7942) | SEFLSSEVITQVRSLLNQGYRIGTEHADKRRFRTSSWQPCAPIQSTNERQVLSELENCLSEHEGEYVRLLGIDTNTRSRVFEALIQRPDGSV |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-08-10 Deposition Author(s): Aigner, H. , Bracher, A. , Hartl, F.U. , Hayer-Hartl, M. , Hee, W.Y. , Long, B.M. , Nguyen, N.D. , Price, G.D. , Wang, H. , Yan, X.