Crystal structure of the small subunit-like domain of rubisco activase from nostoc sp. (strain pcc 7120)
PDB DOI: 10.2210/pdb6has/pdb
Classification: CHAPERONE Organism(s): Nostoc Sp. (Strain Pcc 7120 / Sag 25.82 / Utex 2576)
Deposited: 2018-08-08 Deposition Author(s): Bracher, A. , Popilka, L.
Method: X-RAY DIFFRACTION Resolution: 1.38 Å
Crystal structure of the small subunit-like domain of rubisco activase from nostoc sp. (strain pcc 7120)
Primary Citation of Related Structures: 6HAS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribulose bisphosphate carboxylase/oxygenase activase | A | 90 | Nostoc Sp. (Strain Pcc 7120 / Sag 25.82 / Utex 2576) | HLSLETQEQIRQILSQGHKITFEHVDARRFRTGSWQSCGTLHIDAESDAISTLEACLVDYDGEYVRMVGIDPKGKRRVVETIIQRPNGKN |
| Ribulose bisphosphate carboxylase/oxygenase activase | B | 90 | Nostoc Sp. (Strain Pcc 7120 / Sag 25.82 / Utex 2576) | HLSLETQEQIRQILSQGHKITFEHVDARRFRTGSWQSCGTLHIDAESDAISTLEACLVDYDGEYVRMVGIDPKGKRRVVETIIQRPNGKN |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-08-08 Deposition Author(s): Bracher, A. , Popilka, L.