Crystal structure of paf - p-sulfonatocalix[4]arene complex
PDB DOI: 10.2210/pdb6ha4/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Penicillium Rubens (Strain Atcc 28089 / Dsm 1075 / Nrrl 1951 / Wisconsin 54-1255)
Deposited: 2018-08-07 Deposition Author(s): Alex, J.M. , Batta, G. , Crowley, P.B. , Engilberge, S. , Rennie, M.
Crystal structure of paf - p-sulfonatocalix[4]arene complex
Alex, J.M. , Batta, G. , Crowley, P.B. , Engilberge, S. , Rennie, M.
Primary Citation of Related Structures: 6HA4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Pc24g00380 protein | A | 55 | Penicillium Rubens (Strain Atcc 28089 / Dsm 1075 / Nrrl 1951 / Wisconsin 54-1255) | AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-08-07 Deposition Author(s): Alex, J.M. , Batta, G. , Crowley, P.B. , Engilberge, S. , Rennie, M.