PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6H22

Crystal structure of mdm2 bound to a stapled peptide

PDB DOI: 10.2210/pdb6h22/pdb

Classification: LIGASE
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2018-07-12
Deposition Author(s): Hyvonen, M. , Sharma, K. , Spring, D.R. , Wang, X.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.006 Å

6h22
Literature

Crystal structure of mdm2 bound to a stapled peptide

Hyvonen, M. , Sharma, K. , Spring, D.R. , Wang, X.

Primary Citation of Related Structures: 6H22


Proteins
Molecule Chains Sequence Length Organism Sequence
E3 ubiquitin-protein ligase Mdm2 A 97 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPLGSSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDAAQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV
E3 ubiquitin-protein ligase Mdm2 B 97 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPLGSSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDAAQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV
Stapled peptide C 14 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XLTFAEYWAQLASX
Stapled peptide D 14 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XLTFAEYWAQLASX
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2018-07-12
Deposition Author(s): Hyvonen, M. , Sharma, K. , Spring, D.R. , Wang, X.