6GZL
Complex between the dynein light chain dynll1/dlc8 and a peptide from the large myelin-associated glycoprotein l-mag
PDB DOI: 10.2210/pdb6gzl/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-07-04 Deposition Author(s): Kursula, P. , Myllykoski, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.953 Å
Complex between the dynein light chain dynll1/dlc8 and a peptide from the large myelin-associated glycoprotein l-mag
Primary Citation of Related Structures: 6GZL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dynein light chain 1, cytoplasmic | A | 90 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
| PRO-THR-LYS-ASP-SER-TYR-THR-LEU-THR-GLU-GLU-LEU | B | 17 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRPTKDSYTLTEELAEY |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-07-04 Deposition Author(s): Kursula, P. , Myllykoski, M.