Hybrid structure of the prn1 helix bundle domain in complex with dna and 2 atp molecules
PDB DOI: 10.2210/pdb6gvt/pdb
Classification: DNA BINDING PROTEIN Organism(s): Chikungunya Virus (Strain 37997) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-06-21 Deposition Author(s): Allain, F.H.-T. , Boudet, J. , Lipps, G. , Meier, B.H. , Wiegand, T.
Hybrid structure of the prn1 helix bundle domain in complex with dna and 2 atp molecules
Allain, F.H.-T. , Boudet, J. , Lipps, G. , Meier, B.H. , Wiegand, T.
Primary Citation of Related Structures: 6GVT
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA (5'-D(*CP*TP*GP*TP*GP*CP*TP*CP*A)-3') | a | 9 | NA | CTGTGCTCA |
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
functional pRN1 primase | B | 115 | Chikungunya Virus (Strain 37997) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TVVEFEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADVNIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVITLSKAWSVVKKYLEA |
Method: SOLUTION NMR, SOLID-STATE NMR
Deposited Date: 2018-06-21 Deposition Author(s): Allain, F.H.-T. , Boudet, J. , Lipps, G. , Meier, B.H. , Wiegand, T.