Cadmium(ii) form of a44h mutant of shortened metallothionein from pseudomonas fluorescens q2-87 (residues 1-52)
PDB DOI: 10.2210/pdb6gv7/pdb
Classification: METAL BINDING PROTEIN Organism(s): Pseudomonas Fluorescens Q2-87
Deposited: 2018-06-20 Deposition Author(s): Freisinger, E. , Habjanic, J. , Zerbe, O.
Method: SOLUTION NMR Resolution: N.A.
Cadmium(ii) form of a44h mutant of shortened metallothionein from pseudomonas fluorescens q2-87 (residues 1-52)
Freisinger, E. , Habjanic, J. , Zerbe, O.
Primary Citation of Related Structures: 6GV7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
metallothionein | A | 52 | Pseudomonas Fluorescens Q2-87 | NELRCGCPDCHCKVDPERVFNHDGEAYCSQACAEQHPNGEPCPHPDCHCERS |
Method: SOLUTION NMR
Deposited Date: 2018-06-20 Deposition Author(s): Freisinger, E. , Habjanic, J. , Zerbe, O.