Cell division regulator, b. subtilis gpsb, in complex with peptide fragment of penicillin binding protein pbp1a
PDB DOI: 10.2210/pdb6gp7/pdb
Classification: CELL CYCLE Organism(s): Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct
Deposited: 2018-06-05 Deposition Author(s): Cleverley, R.M. , Lewis, R.J.
Method: X-RAY DIFFRACTION Resolution: 1.95002 Å
Cell division regulator, b. subtilis gpsb, in complex with peptide fragment of penicillin binding protein pbp1a
Primary Citation of Related Structures: 6GP7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cell cycle protein GpsB | B | 63 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | GHMKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKKQLEE |
Cell cycle protein GpsB | A | 63 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | GHMKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKKQLEE |
PBP1A | D | 17 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | MSDQFNSREARRKANSK |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-05 Deposition Author(s): Cleverley, R.M. , Lewis, R.J.