Three dimensional structure of a novel influenza hemagglutinin tri-stalk protein
PDB DOI: 10.2210/pdb6gol/pdb
Classification: VIRAL PROTEIN Organism(s): Influenza A Virus (A/California/Vrdl69/2009(H1N1))
Deposited: 2018-06-01 Deposition Author(s): Kazaks, A. , Kirsteina, A. , Tars, K.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Three dimensional structure of a novel influenza hemagglutinin tri-stalk protein
Kazaks, A. , Kirsteina, A. , Tars, K.
Primary Citation of Related Structures: 6GOL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hemagglutinin tri-stalk | A | 72 | Influenza A Virus (A/California/Vrdl69/2009(H1N1)) | MNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNA |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-01 Deposition Author(s): Kazaks, A. , Kirsteina, A. , Tars, K.