Crystal structure of hmth1 n33g in complex with th scaffold 1 in the presence of acetate
PDB DOI: 10.2210/pdb6glr/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2018-05-23 Deposition Author(s): Caflisch, A. , Eberle, S.A. , Sledz, P. , Wiedmer, L.
Crystal structure of hmth1 n33g in complex with th scaffold 1 in the presence of acetate
Caflisch, A. , Eberle, S.A. , Sledz, P. , Wiedmer, L.
Primary Citation of Related Structures: 6GLR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 7,8-dihydro-8-oxoguanine triphosphatase | A | 182 | Homo Sapiens | MKHHHHHHPMSDYDIPTTENLYFQGAMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWGGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV |
| 7,8-dihydro-8-oxoguanine triphosphatase | B | 182 | Homo Sapiens | MKHHHHHHPMSDYDIPTTENLYFQGAMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWGGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-23 Deposition Author(s): Caflisch, A. , Eberle, S.A. , Sledz, P. , Wiedmer, L.