6GL8
Crystal structure of bcl-2 in complex with the novel orally active inhibitor s55746
PDB DOI: 10.2210/pdb6gl8/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2018-05-23 Deposition Author(s): Amiot, M. , Bruno, A. , Casara, P. , Chanrion, M. , Chen, I. , Claperon, A. , Cohen, G.M. , Colland, F. , Davidson, J. , Dokurno, P. , Dyer, M.J.S. , Geneste, O. , Girard, A.M. , Graham, C. , Grave, F. , Guasconi, G. , Henlin, J.M. , Hickman, J.A. , Hubbard, R. , Kraus-Berthier, L. , Le Diguarher, T. , Le Gouill, S. , Le Toumelin-Braizat, G. , Lysiak-Auvity, G. , Maiga, S. , Matassova, N. , Morris, E. , Murray, J. , Pedder, C. , Qiu, S. , Rocchetti, F. , Schneider, E. , Starck, J.B. , Studeny, A. , Vogler, M. , Wang, Y. , Whitehead, N. , Wood, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Crystal structure of bcl-2 in complex with the novel orally active inhibitor s55746
Amiot, M. , Bruno, A. , Casara, P. , Chanrion, M. , Chen, I. , Claperon, A. , Cohen, G.M. , Colland, F. , Davidson, J. , Dokurno, P. , Dyer, M.J.S. , Geneste, O. , Girard, A.M. , Graham, C. , Grave, F. , Guasconi, G. , Henlin, J.M. , Hickman, J.A. , Hubbard, R. , Kraus-Berthier, L. , Le Diguarher, T. , Le Gouill, S. , Le Toumelin-Braizat, G. , Lysiak-Auvity, G. , Maiga, S. , Matassova, N. , Morris, E. , Murray, J. , Pedder, C. , Qiu, S. , Rocchetti, F. , Schneider, E. , Starck, J.B. , Studeny, A. , Vogler, M. , Wang, Y. , Whitehead, N. , Wood, M.
Primary Citation of Related Structures: 6GL8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2,Bcl-2-like protein 1,Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2 | A | 172 | Homo Sapiens | MHHHHHHHHLVPRGSYDNREIVMKYIHYKLSQRGYEWDAGADVEENRTEAPEGTESEVVHKTLREAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSM |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-23 Deposition Author(s): Amiot, M. , Bruno, A. , Casara, P. , Chanrion, M. , Chen, I. , Claperon, A. , Cohen, G.M. , Colland, F. , Davidson, J. , Dokurno, P. , Dyer, M.J.S. , Geneste, O. , Girard, A.M. , Graham, C. , Grave, F. , Guasconi, G. , Henlin, J.M. , Hickman, J.A. , Hubbard, R. , Kraus-Berthier, L. , Le Diguarher, T. , Le Gouill, S. , Le Toumelin-Braizat, G. , Lysiak-Auvity, G. , Maiga, S. , Matassova, N. , Morris, E. , Murray, J. , Pedder, C. , Qiu, S. , Rocchetti, F. , Schneider, E. , Starck, J.B. , Studeny, A. , Vogler, M. , Wang, Y. , Whitehead, N. , Wood, M.