Nmr structure of the scorpion toxin ammtx3
PDB DOI: 10.2210/pdb6ggz/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2018-05-04 Deposition Author(s): Landon, C. , Meudal, H.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the scorpion toxin ammtx3
Primary Citation of Related Structures: 6GGZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Potassium channel toxin alpha-KTx 15.3 | 1 | 37 | N.A. | QIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP |
Method: SOLUTION NMR
Deposited Date: 2018-05-04 Deposition Author(s): Landon, C. , Meudal, H.