Antinociceptive evaluation of cyriotoxin-1a, the first toxin purified from cyriopagopus schioedtei spider venom
PDB DOI: 10.2210/pdb6gft/pdb
Classification: TOXIN Organism(s): Granulicella Mallensis (Strain Atcc Baa-1857 / Dsm 23137 / Mp5Actx8)
Deposited: 2018-05-02 Deposition Author(s): Kurz, M.
Method: SOLUTION NMR Resolution: N.A.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
cyriotoxin-1a | A | 34 | Granulicella Mallensis (Strain Atcc Baa-1857 / Dsm 23137 / Mp5Actx8) | ECKGFGKSCVPGKNECCSGLTCSNKHKWCKVLLX |
Method: SOLUTION NMR
Deposited Date: 2018-05-02 Deposition Author(s): Kurz, M.