X-ray structure of nsd3-pwwp1 in complex with compound bi-9321
PDB DOI: 10.2210/pdb6g2o/pdb
Classification: ONCOPROTEIN Organism(s): Homo Sapiens
Deposited: 2018-03-23 Deposition Author(s): Boettcher, J. , Muellauer, B.J. , Weiss-Puxbaum, A. , Zoephel, A.
X-ray structure of nsd3-pwwp1 in complex with compound bi-9321
Boettcher, J. , Muellauer, B.J. , Weiss-Puxbaum, A. , Zoephel, A.
Primary Citation of Related Structures: 6G2O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone-lysine N-methyltransferase NSD3 | A | 136 | Homo Sapiens | STGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKINTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPRPQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-03-23 Deposition Author(s): Boettcher, J. , Muellauer, B.J. , Weiss-Puxbaum, A. , Zoephel, A.