Protein environment affects the water-tryptophan binding mode. molecular dynamics simulations of engrailed homeodomain mutants
PDB DOI: 10.2210/pdb6fvc/pdb
Classification: DNA BINDING PROTEIN Organism(s): Murine Hepatitis Virus
Deposited: 2018-03-02 Deposition Author(s): Jansen, S. , Kozelka, J. , Srb, P. , Trosanova, Z. , Zachrdla, M. , Zidek, L.
Protein environment affects the water-tryptophan binding mode. molecular dynamics simulations of engrailed homeodomain mutants
Jansen, S. , Kozelka, J. , Srb, P. , Trosanova, Z. , Zachrdla, M. , Zidek, L.
Primary Citation of Related Structures: 6FVC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Segmentation polarity homeobox protein engrailed | A | 64 | Murine Hepatitis Virus | GAMEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNERAKIKKSGS |
Method: SOLUTION NMR
Deposited Date: 2018-03-02 Deposition Author(s): Jansen, S. , Kozelka, J. , Srb, P. , Trosanova, Z. , Zachrdla, M. , Zidek, L.