Crystal structure of oxidised flavodoxin 1 from bacillus cereus (1.27 a resolution)
PDB DOI: 10.2210/pdb6fsg/pdb
Classification: ELECTRON TRANSPORT Organism(s): Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711)
Deposited: 2018-02-19 Deposition Author(s): Gudim, I. , Hersleth, H.-P. , Lofstad, M.
Method: X-RAY DIFFRACTION Resolution: 1.27 Å
Crystal structure of oxidised flavodoxin 1 from bacillus cereus (1.27 a resolution)
Gudim, I. , Hersleth, H.-P. , Lofstad, M.
Primary Citation of Related Structures: 6FSG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Flavodoxin | A | 147 | Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711) | SKLVMIFASMSGNTEEMADHIAGVIRETENEIEVIDIMDSPEASILEQYDGIILGAYTWGDGDLPDDFLDFYDAMDSIDLTGKKAAVFGSCDSAYPKYGVAVDILIEKLQERGAAVVLEGLKVELTPEDEDVEKCLQFGAEFVKHLS |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-02-19 Deposition Author(s): Gudim, I. , Hersleth, H.-P. , Lofstad, M.