Crystal structure of baz2a phd zinc finger in complex with h3 3-mer peptide
PDB DOI: 10.2210/pdb6fhu/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2018-01-15 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of baz2a phd zinc finger in complex with h3 3-mer peptide
Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.
Primary Citation of Related Structures: 6FHU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bromodomain adjacent to zinc finger domain protein 2A | A | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | B | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | C | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | D | 58 | Homo Sapiens , Synthetic Construct | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
ALA-ARG-TAM | F | 3 | Homo Sapiens , Synthetic Construct | ARX |
ALA-ARG-TAM | H | 3 | Homo Sapiens , Synthetic Construct | ARX |
ALA-ARG-TAM | G | 3 | Homo Sapiens , Synthetic Construct | ARX |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-01-15 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.