6FFU
Solution nmr structure of cbm64 from s.thermophila using 20% 13c, 100% 15n
PDB DOI: 10.2210/pdb6ffu/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Streptomyces Viridochromogenes (Strain Dsm 40736 / Jcm 4977 / Bcrc 1201 / Tue 494)
Deposited: 2018-01-09 Deposition Author(s): Heikkinen, H.A. , Iwai, H.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of cbm64 from s.thermophila using 20% 13c, 100% 15n
Primary Citation of Related Structures: 6FFU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glycosyl hydrolase family 5 cellulase CBM64 | A | 86 | Streptomyces Viridochromogenes (Strain Dsm 40736 / Jcm 4977 / Bcrc 1201 / Tue 494) | SGEYTEIALPFSYDGAGEYYWKTDQFSTDPNDWSRYVNSWNLDLLEINGTDYTNVWVAQHQIPAASDGYWYIHYKSGVSWGHVEIK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2018-01-09 Deposition Author(s): Heikkinen, H.A. , Iwai, H.