Solution nmr structure of cbm64 from s.thermophila
PDB DOI: 10.2210/pdb6ffq/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Streptomyces Viridochromogenes (Strain Dsm 40736 / Jcm 4977 / Bcrc 1201 / Tue 494)
Deposited: 2018-01-09 Deposition Author(s): Heikkinen, H.A. , Iwai, H.
Solution nmr structure of cbm64 from s.thermophila
Primary Citation of Related Structures: 6FFQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Glycosyl hydrolase family 5 cellulase CBM64 | A | 86 | Streptomyces Viridochromogenes (Strain Dsm 40736 / Jcm 4977 / Bcrc 1201 / Tue 494) | SGEYTEIALPFSYDGAGEYYWKTDQFSTDPNDWSRYVNSWNLDLLEINGTDYTNVWVAQHQIPAASDGYWYIHYKSGVSWGHVEIK |
Method: SOLUTION NMR
Deposited Date: 2018-01-09 Deposition Author(s): Heikkinen, H.A. , Iwai, H.