Crystal structure of the human retinoid x receptor dna-binding domain bound to the human mep dr1 response element, ph 7.0
PDB DOI: 10.2210/pdb6fbq/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-12-19 Deposition Author(s): Mcewen, A.G. , Osz, J. , Poussin-Courmontagne, P. , Rochel, N.
Crystal structure of the human retinoid x receptor dna-binding domain bound to the human mep dr1 response element, ph 7.0
Mcewen, A.G. , Osz, J. , Poussin-Courmontagne, P. , Rochel, N.
Primary Citation of Related Structures: 6FBQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Retinoic acid receptor RXR-alpha | A | 87 | Homo Sapiens , Synthetic Construct | GSHMFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRG |
| Retinoic acid receptor RXR-alpha | B | 87 | Homo Sapiens , Synthetic Construct | GSHMFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-12-19 Deposition Author(s): Mcewen, A.G. , Osz, J. , Poussin-Courmontagne, P. , Rochel, N.