Crystal structure of human baz2a phd zinc finger in complex with fr23
PDB DOI: 10.2210/pdb6fap/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2017-12-16 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.
Method: X-RAY DIFFRACTION Resolution: 2.7 Å
Crystal structure of human baz2a phd zinc finger in complex with fr23
Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.
Primary Citation of Related Structures: 6FAP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bromodomain adjacent to zinc finger domain protein 2A | A | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | B | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | C | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | D | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-12-16 Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.