PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6FAP

Crystal structure of human baz2a phd zinc finger in complex with fr23

PDB DOI: 10.2210/pdb6fap/pdb

Classification: TRANSCRIPTION
Organism(s): Salmonella Enterica

Deposited: 2017-12-16
Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.7 Å

Literature

Crystal structure of human baz2a phd zinc finger in complex with fr23

Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.

Primary Citation of Related Structures: 6FAP


Proteins
Molecule Chains Sequence Length Organism Sequence
Bromodomain adjacent to zinc finger domain protein 2A A 58 Salmonella Enterica HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Bromodomain adjacent to zinc finger domain protein 2A B 58 Salmonella Enterica HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Bromodomain adjacent to zinc finger domain protein 2A C 58 Salmonella Enterica HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Bromodomain adjacent to zinc finger domain protein 2A D 58 Salmonella Enterica HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2017-12-16
Deposition Author(s): Amato, A. , Bortoluzzi, A. , Ciulli, A. , Lucas, X. , Wright, D.