Structure of the transmembrane helix of bclxl in phospholipid nanodiscs
PDB DOI: 10.2210/pdb6f46/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2017-11-29 Deposition Author(s): Hagn, F. , Raltchev, K.
Method: SOLUTION NMR Resolution: N.A.
Structure of the transmembrane helix of bclxl in phospholipid nanodiscs
Primary Citation of Related Structures: 6F46
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bcl-2-like protein 1 | A | 35 | Homo Sapiens | GSGESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK |
Method: SOLUTION NMR
Deposited Date: 2017-11-29 Deposition Author(s): Hagn, F. , Raltchev, K.