Pdzk1 domain 4 in complex with c-terminal peptide of human pept2.
PDB DOI: 10.2210/pdb6ezi/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-11-15 Deposition Author(s): Flayhan, A. , Loew, C. , Pieprzyk, J.
Pdzk1 domain 4 in complex with c-terminal peptide of human pept2.
Flayhan, A. , Loew, C. , Pieprzyk, J.
Primary Citation of Related Structures: 6EZI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Na(+)/H(+) exchange regulatory cofactor NHE-RF3 | A | 89 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMHKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAY |
Solute carrier family 15 member 2 | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IKLETKKTKL |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-11-15 Deposition Author(s): Flayhan, A. , Loew, C. , Pieprzyk, J.