Structure of the apo form of aiox from rhizobium sp. str. nt-26
PDB DOI: 10.2210/pdb6esk/pdb
Classification: SIGNALING PROTEIN Organism(s): Rhizobium Sp. Nt-26
Deposited: 2017-10-20 Deposition Author(s): Badilla, C. , Cole, A. , Djordjevic, S. , Santini, J.
Structure of the apo form of aiox from rhizobium sp. str. nt-26
Badilla, C. , Cole, A. , Djordjevic, S. , Santini, J.
Primary Citation of Related Structures: 6ESK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative periplasmic phosphite-binding-like protein (Pbl) PtxB-like protein designated AioX | A | 266 | Rhizobium Sp. Nt-26 | GASEPMRPGVIRFGLTPVFLSNDLEVLDELQAYLTQAVGQEVQLITQRTYQEVTALLVSGNLEAAWICGYPFMKFRDELDLVATPLWRGKPVYQSYLIVGRDRDIAGFEDCQGDIHAFSDPDSNSGYLVTKTYLAERGVSEEGFFRKSFFTYGHRNVIRAVASGLADSGSVDGYVWEVMKTTEPELVAKTRVLVKSGWHGFPPVAAAAGQRKSQAVARIRSALLDMNQEVLGRSVLTRLQLDGFVETTAESYDSIAANMERVRRLG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-10-20 Deposition Author(s): Badilla, C. , Cole, A. , Djordjevic, S. , Santini, J.