Mth1 in complex with fragment 1
PDB DOI: 10.2210/pdb6eq6/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2017-10-12 Deposition Author(s): Caflisch, A. , Sledz, P. , Wiedmer, L.
Method: X-RAY DIFFRACTION Resolution: 2.002 Å
Mth1 in complex with fragment 1
Caflisch, A. , Sledz, P. , Wiedmer, L.
Primary Citation of Related Structures: 6EQ6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 7,8-dihydro-8-oxoguanine triphosphatase | A | 182 | Homo Sapiens | MKHHHHHHPMSDYDIPTTENLYFQGAMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-10-12 Deposition Author(s): Caflisch, A. , Sledz, P. , Wiedmer, L.