Crystal structure of a gnat superfamily pa3944 acetyltransferase in complex with coa (p1 space group)
PDB DOI: 10.2210/pdb6edd/pdb
Classification: TRANSFERASE Organism(s): Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1)
Deposited: 2018-08-09 Deposition Author(s): Center For Structural Genomics Of Infectious Diseases (Csgid) , Czub, M.P. , Joachimiak, A. , Majorek, K.A. , Minor, W. , Porebski, P.J. , Satchell, K.J.
Crystal structure of a gnat superfamily pa3944 acetyltransferase in complex with coa (p1 space group)
Center For Structural Genomics Of Infectious Diseases (Csgid) , Czub, M.P. , Joachimiak, A. , Majorek, K.A. , Minor, W. , Porebski, P.J. , Satchell, K.J.
Primary Citation of Related Structures: 6EDD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Acetyltransferase PA3944 | A | 194 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | GHMNANLPPSAISELHGPRLLLRAWRDSDREAFAEMCADPQVMEFFPSVLDRAQSDALVDRVQAHFAERGYGPWALELPGEAAFIGFTGLFDVTMDVHFAPTVEIGWRLAPAYWGRGLAREAAETALDFAFERLRLPEVVAFTTPPNRRSWGLMERLGMRRDPAEDFDHPLLAADHPMRRHILYRVDAARWAER |
| Acetyltransferase PA3944 | B | 194 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | GHMNANLPPSAISELHGPRLLLRAWRDSDREAFAEMCADPQVMEFFPSVLDRAQSDALVDRVQAHFAERGYGPWALELPGEAAFIGFTGLFDVTMDVHFAPTVEIGWRLAPAYWGRGLAREAAETALDFAFERLRLPEVVAFTTPPNRRSWGLMERLGMRRDPAEDFDHPLLAADHPMRRHILYRVDAARWAER |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-08-09 Deposition Author(s): Center For Structural Genomics Of Infectious Diseases (Csgid) , Czub, M.P. , Joachimiak, A. , Majorek, K.A. , Minor, W. , Porebski, P.J. , Satchell, K.J.