Structure determination of a dimeric form of erabutoxin b, crystallized from thiocyanate solution
PDB DOI: 10.2210/pdb6ebx/pdb
Classification: TOXIN Organism(s): Laticauda Semifasciata
Deposited: 1991-05-31 Deposition Author(s): Prange, T. , Saludjian, P.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Structure determination of a dimeric form of erabutoxin b, crystallized from thiocyanate solution
Primary Citation of Related Structures: 6EBX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ERABUTOXIN B | A | 62 | Laticauda Semifasciata | RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN |
| ERABUTOXIN B | B | 62 | Laticauda Semifasciata | RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN |
Method: X-RAY DIFFRACTION
Deposited Date: 1991-05-31 Deposition Author(s): Prange, T. , Saludjian, P.