Crystal structure of zbtb38 c-terminal zinc fingers 6-9 in complex with methylated dna
PDB DOI: 10.2210/pdb6e93/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-07-31 Deposition Author(s): Buck-Koehntop, B.A. , Hudson, N.O. , Whitby, F.G.
Crystal structure of zbtb38 c-terminal zinc fingers 6-9 in complex with methylated dna
Buck-Koehntop, B.A. , Hudson, N.O. , Whitby, F.G.
Primary Citation of Related Structures: 6E93
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger and BTB domain-containing protein 38 | A | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TSRPYACELCAKQFQSPSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHERIHLGLKEFVCQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQRFLYLSTKRNHEQRHIREHNGKG |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-07-31 Deposition Author(s): Buck-Koehntop, B.A. , Hudson, N.O. , Whitby, F.G.