6E83
Solution structure of zzz3 zz domain in complex with histone h3 tail
PDB DOI: 10.2210/pdb6e83/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2018-07-27 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of zzz3 zz domain in complex with histone h3 tail
Primary Citation of Related Structures: 6E83
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ZZ-type zinc finger-containing protein 3 | B | 64 | Homo Sapiens , Synthetic Construct | GPLGSVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYR |
| Histone H3 | A | 12 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2018-07-27 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.